deamidation comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2026-05-14. Where a claim depends on a specific study, the study is described rather than over-claimed.
Degradation pathways for tirzepatide include deamidation, oxidation, and aggregation, which are common for therapeutic peptides. These processes can be monitored by size-exclusion chromatography (SEC) for aggregates and ion-exchange chromatography for charge variants. Forced degradation studies under acidic, basic, oxidative, and thermal stress help identify potential impurities. The exact stability profile depends on formulation, concentration, and container-closure system.
Analytical characterization of tirzepatide typically employs reversed-phase high-performance liquid chromatography (RP-HPLC) for purity assessment and peptide mapping. Mass spectrometry, often coupled with electrospray ionization, confirms molecular weight and sequence integrity. Amino acid analysis and capillary electrophoresis may also be used to detect impurities or degradation products. These methods are essential for batch release and stability studies.
Storage recommendations for tirzepatide generally specify refrigeration at 2–8 °C to maintain stability. The peptide should be protected from light and kept in its original packaging to prevent aggregation or adsorption. Freezing is not recommended because freeze-thaw cycles can cause aggregation or precipitation. Once dispensed, storage conditions and in-use periods follow product-specific labeling, which may allow room temperature storage for a limited time.
Cold-chain handling is standard for formulated product, with dry powder stored frozen and ready-to-use solutions refrigerated. Light exposure is minimized because photodegradation of certain amino acid side chains is possible. Shipping and temperature-excursion studies are used to establish whether short deviations affect quality attributes. Documentation supplied with research material usually includes a certificate of analysis listing purity, identity confirmation, and water or residual solvent content. Users are expected to confirm that material meets the stated specification before use.
Identity and purity of tirzepatide are assessed mainly by reversed-phase high-performance liquid chromatography with ultraviolet detection, often paired with mass spectrometry. Because the molecule carries several modifications, gradient conditions are adjusted to resolve the intact peptide from deamidation and oxidation products. Enzymatic digestion followed by peptide mapping confirms the primary sequence and locates specific modifications. Quantitation in biological matrices typically uses liquid chromatography with tandem mass spectrometry after solid-phase extraction. Immunoassays are used less often, since antibody cross-reactivity with closely related peptides can bias results.
| Property | Value | Notes |
|---|---|---|
| Appearance | White to off-white powder | Lyophilized or solid form |
| Solubility | Sparingly soluble in water | May require buffer or pH adjustment |
| Typical storage temperature | 2–8 °C | Refrigerated; protect from light |
| Common analytical method | RP-HPLC | For purity and impurity profiling |
| Molecular weight | Approximately 4813 Da | For the peptide backbone; varies with counterions |
Development of tirzepatide took place under a research program that sought to test whether simultaneous engagement of two incretin receptors would produce greater metabolic effects than single-receptor agonism. Clinical trials were organized into the SURPASS series for type 2 diabetes and the SURMOUNT series for obesity and weight management. Regulatory clearance for type 2 diabetes came in 2022 in the United States, followed by approval for chronic weight management in 2023. The trial programs reported reductions in glycated hemoglobin and body weight relative to comparators, though long-term cardiovascular and durability data continue to accumulate.
The peptide backbone contains 39 amino acids and includes alpha-aminoisobutyric acid residues, which are not among the standard proteinogenic set. A C20 fatty diacid moiety is attached through a linker, allowing the compound to bind serum albumin and extend its circulation time. This albumin binding is the main reason the molecule supports once-weekly administration rather than more frequent dosing. The measured molecular mass is approximately 4,813 daltons, placing it firmly in the peptide rather than small-molecule class.
Tirzepatide is a synthetic peptide that activates both the glucose-dependent insulinotropic polypeptide (GIP) and glucagon-like peptide-1 (GLP-1) receptors. This dual agonist profile distinguishes it from earlier incretin-based compounds that act on a single receptor. The molecule was engineered from the native GIP sequence and carries several non-natural residues that slow enzymatic breakdown. Researchers designed it to combine the insulinotropic effects of GIP signaling with the appetite and gastric-emptying effects associated with GLP-1 activation.
Tirzepatide is a synthetic peptide built from 39 amino acid residues. Its sequence is related to human glucose-dependent insulinotropic polypeptide, with modifications that include a C-terminal extension and a C20 fatty diacid joined through a linker. Those changes raise the molecule's affinity for serum albumin, which slows renal filtration and lengthens the time it stays in circulation. The free base has an average molecular mass near 4813.5 daltons. The compound is made by solid-phase peptide synthesis followed by chromatographic purification.
At the receptor level, tirzepatide activates both the glucose-dependent insulinotropic polypeptide receptor and the glucagon-like peptide-1 receptor. Both belong to the class B family of G protein-coupled receptors and signal largely through cyclic AMP accumulation. The compound binds the two receptors with differing affinity, and the pattern of signaling at each site is described in the literature as biased rather than simply proportional to occupancy. Tissues carrying these receptors include pancreatic islets, adipose tissue, the central nervous system, and the gastrointestinal tract. The relative weight of each receptor population in producing metabolic effects continues to be studied.
== Career == Huttenlocher joined the faculty at the University of Wisconsin–Madison (UW-M) in 1999 with a joint appointment in the Departments of Pediatrics and Pharmacology, and as an associate director of the Medical Scientist Training Program (MSTP). In this role, Huttenlocher's research has defined cellular and molecular mechanisms that regulate cell migration and identified basic adhesive mechanisms that regulate cell migration and leukocyte chemotaxis. By 2005, her research team had identified a novel pathway that turned out to be critical for cell migration and chemotaxis, involving intracellular proteolysis by the calcium-dependent protease calpain. Her laboratory was also the first to document reverse migration of neutrophils away from sites of injury or inflammation. In 2011 her group reported the first redox sensor that mediates leukocyte attraction to wounds. In 2005 she was elected a member of the American Society for Clinical Investigation. Huttenlocher was promoted to Professor with tenure in 2008 and was the recipient of the Graduate School’s H.I. Romnes Fellowship award. She also received the Burroughs-Wellcome Fund’s Clinical Scientist Award in Translational Research for her project "Diagnosis and Treatment of Autoinflammatory Disease." Huttenlocher was the recipient of a 2011 WARF Kellett Mid-Career Award. Until 2023 she conducted this work while maintaining an active clinical practice as a pediatric rheumatologist. In 2012, Huttenlocher was appointed as Director of the UW-Madison MD-PhD training program (MSTP), succeeding Deane Mosher.
== Occurrence == To date, the highest natural concentration of 1-methylnicotinamide has been found in the alga Undaria pinnatifida (3.2 mg/100 g of dried algae) and green tea leaves (3 mg/100 g of product). Other products with notable 1-MNA content include celery (1.6 mg/100 g of product), Chinese black mushrooms (shiitake, 1.3 mg/100 g), and fermented soybeans (natto, 1.0 mg/100 g).
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP.
=== Therapeutic foods === Due in part to limited research on supplementary feeding, there is little evidence that this strategy is beneficial. A 2015 systematic review of 32 studies found that there are limited benefits when children under 5 receive supplementary feeding, especially among younger, poorer, and more undernourished children. However, specially formulated foods do appear to be useful in treating moderate acute malnutrition in the developing world. These foods may have additional benefits in humanitarian emergencies, since they can be stored for years, can be eaten directly from the packet, and do not have to be mixed with clean water or refrigerated. In young children with severe acute malnutrition, it is unclear if ready-to-use therapeutic food differs from a normal diet. Severely malnourished individuals can experience refeeding syndrome if fed too quickly. Refeeding syndrome can result regardless of whether food is taken orally, enterally or parenterally. It can present several days after eating with potentially fatal heart failure, dysrhythmias, and confusion. Some manufacturers have fortified everyday foods with micronutrients before selling them to consumers. For example, flour has been fortified with iron, zinc, folic acid, and other B vitamins like thiamine, riboflavin, niacin and vitamin B12. Baladi bread (Egyptian flatbread) is made with fortified wheat flour. Other fortified products include fish sauce in Vietnam and iodized salt.
More recently, it has become much more commonplace to use ethyl chloroformate instead of cyanogen bromide for the Von Braun degradation demethylation step. See for example the list of phenyltropanes or the synthesis of paroxetine for further examples of this.
Sources: en.wikipedia.org
=== Projection (plain) radiography === Radiographs (originally called roentgenographs, named after the discoverer of X-rays, Wilhelm Conrad Röntgen) are produced by transmitting X-rays through a patient. The X-rays are projected through the body onto a detector; an image is formed based on which rays pass through (and are detected) versus those that are absorbed or scattered in the patient (and thus are not detected). Röntgen discovered X-rays on November 8, 1895, and received the first Nobel Prize in Physics in 1901 for this discovery. In film-screen radiography, an X-ray tube generates a beam of X-rays, which is aimed at the patient. The X-rays that pass through the patient are filtered through a device called a grid or X-ray filter, to reduce scatter, and strike an undeveloped film, which is held tightly to a screen of light-emitting phosphors in a light-tight cassette. The film is then developed chemically and an image appears on the film. Film-screen radiography is being replaced by phosphor plate radiography but more recently by digital radiography (DR) and the EOS imaging. In the two latest systems, the X-rays strike sensors that convert the signals generated into digital information, which is transmitted and converted into an image displayed on a computer screen. In digital radiography the sensors shape a plate, but in the EOS system, which is a slot-scanning system, a linear sensor vertically scans the patient. Plain radiography was one of the earliest imaging modalities used in clinical medicine and remained the most widely used for several decades.
=== Clinical significance === Interstitial deletions of chromosome 3 are rare, and only a few patients with a microdeletion of 3p21.31 have been reported to date. Characteristic clinical features found in patients with a microdeletion of 3p21.31 include developmental delay and distinctive facial features (including arched eyebrows, hypertelorism, epicanthus, and micrognathia). In the gene region, NCBI SNP identified 1,326 SNPS on the reverse minus strand of C3orf62. In the coding region, NCBI SNP identified 147 common SNPs.
=== Genetic continuity between ancient and modern Han Chinese === The Hengbei archaeological site in Jiang County, southern Shanxi was part of the suburbs of the capital during the Zhou dynasty. Genetic material from human remains in Hengbei have been used to examine the genetic continuity between ancient and modern Han Chinese. Comparisons of Y chromosome single-nucleotide polymorphisms (SNPs) and mitochondrial DNA (mtDNA) between modern Northern Han Chinese and 3,000-year-old Hengbei samples reveal extreme similarity, confirming genetic continuity between ancient Hengbei inhabitants to present-day Northern Han Chinese. This shows that the core genetic structure of Northern Han Chinese was established more than three thousand years ago in the Central Plains Area. These Hengbei inhabitants also "shared close genetic distances" with ancient Di-Qiang peoples from the Mogou site in Gansu. Additionally, these studies indicate that contemporary northern and southern Han Chinese populations exhibit an almost identical Y-DNA genetic structure, indicating a common paternal descent, corroborating the historical record of Han Chinese migration to the south. However, a study of mitochondrial DNA from Yinxu commoner graves in the Shang dynasty showed similarity with modern Northern Han Chinese, but significant differences from southern Han Chinese, indicating admixture on the matriline. A 2026 study showed significant genetic continuity within Central Plains populations.
an intermediate or building block in the synthesis of non-ionic and other surfactants and related functional additives; a component of lubricant and plastic additive systems, including thermoplastic polyurethanes, where long-chain alcohols are used to modify flexibility and permeability; a minor constituent of policosanol-type mixtures employed in cosmetics and personal-care products as part of the lipid phase of creams and emulsions. Because of its chain length and structural similarity to other fatty alcohols, 1-heneicosanol is also used as a reference compound and analytical standard in studies of plant waxes, policosanol mixtures and related lipid fractions. Available safety data sheets describe 1-heneicosanol as a low-volatility solid that is not classified as hazardous under European CLP regulations, but which may cause mild irritation to the skin, eyes and respiratory tract on contact or inhalation of dust. Standard laboratory precautions such as avoiding dust formation, using local exhaust ventilation and wearing eye and skin protection are recommended.
Sources: en.wikipedia.org
Though an effective antibiotic when all others fail, against extremely drug resistant infections, it has many side effects. including inhibition of monoamine oxidase, and as with other nitrofurans generally, minimum inhibitory concentrations also produce systemic toxicity, resulting in tremors, convulsions, peripheral neuritis, gastrointestinal disturbances, and depression of spermatogenesis. Nitrofurans are recognized by FDA as mutagens/carcinogens, and can no longer be used in food-producing animals in the United States as of 1991. Nitrofurazone Nitrofurantoin Norwich Pharmacal Co. & Others v Customs and Excise Commissioners Peptic ulcers and Helicobacter pylori
80. Am Fam Physician. 2026 Sep;114(3):283-294. Foodborne Illness: Diagnosis and Management. Reedy-Cooper A MD, MPH(1), Perez J DO(2), Yurkonis T DO, MHSA(2). Author information: (1)Texas Tech Health Sciences Center El Paso, Texas. (2)Pennsylvania State University College of Medicine, Hershey, Penn. Foodborne illness affects an estimated 48 million people in the United States each year, resulting in 128,000 hospitalizations and 3,000 deaths. Causes of foodborne illnesses include viruses such as norovirus; bacteria such as Escherichia coli, Salmonella, Campylobacter, and Listeria; and parasites such as Giardia. Factors that contribute to foodborne illness include contamination of food by an animal or environmental source before final preparation, improper food handling by an ill worker, inadequate cooking, improper temperature control, and consumption of uncooked or unpasteurized foods. Common symptoms include vomiting, diarrhea, fever, and abdominal pain. Diagnosis and management of foodborne illness should be guided by epidemiologic context, host risk factors, and clinical severity. Empiric treatment includes symptom management, rehydration, and antibiotic therapy. Prevention of foodborne illnesses involves education on food recalls and proper storage, handling, and cooking of food. Foodborne illnesses should be reported to local and state health agencies.
Ruthenium has no radioactive isotopes with half-lives much longer than a year and the price of ruthenium is relatively high, making the destruction of 99Tc into a potentially lucrative source of producing a precious metal from an undesirable feedstock.
Sources: en.wikipedia.org
RP-HPLC is widely used for purity and impurity profiling. Mass spectrometry confirms identity.
Typically refrigerated at 2–8 °C. Protect from light and avoid freezing.
Deamidation, oxidation, and aggregation products. SEC and ion-exchange chromatography are used.
Reversed-phase liquid chromatography with ultraviolet detection is the usual approach, frequently combined with mass spectrometry for identity. Purity is reported as the area percentage of the main peak. Related impurities eluting near the main peak are usually summed and reported separately.